SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014889 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000014889
Domain Number - Region: 520-594
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0012
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014889   Gene: ENSPPYG00000013313   Transcript: ENSPPYT00000015486
Sequence length 605
Comment pep:known_by_projection chromosome:PPYG2:2b:130174502:130340652:1 gene:ENSPPYG00000013313 transcript:ENSPPYT00000015486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMGTQGSGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARAEAREIRMKELERQQK
EIYQVQKKYYGLDTKWGDIEQWMEDSERYSRRSRRNTSASDEDERMSVGSRGSLRSQPDL
EYGGPYAWASVLDEGSFSGARRGSTCGSRAPSEYSSHLNSSSRASSRASSARASPVVEER
PEKDFTEKGSRSMPGLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKELNELKDQIQ
DVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLA
ESRRQYEEKNKEFEREKHAHSILQFQFAEVKEALKQREEMLEEIRQLQQKQASSIREISD
LQETIEWKDKKIGALERQKEFFDSVRSERDDLREEVVMLKEELKKHGIILNSEIATNGET
SDTLNNVGYQGPTKMTKEELNALKSTGDGTLDIRLKKLVDERECLLEQIKKLKGQLEERQ
KIGKLDNLRSEDDVLENGTDVHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLES
QVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSA
LLSQQ
Download sequence
Identical sequences H2P921
ENSPPYP00000014889 ENSPPYP00000014889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]