SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014900 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014900
Domain Number 1 Region: 71-114
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000275
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014900   Gene: ENSPPYG00000013323   Transcript: ENSPPYT00000015497
Sequence length 205
Comment pep:known_by_projection chromosome:PPYG2:2b:130826582:130827600:-1 gene:ENSPPYG00000013323 transcript:ENSPPYT00000015497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELTVRRVQGVLR
SRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGS
SFQDLLGDALAGPPGAPGRSGWPAGEAPGSPIPSPPGPGDDLCSDLEEAPEAELSRAPAE
GPDLVPAALGSLTAAQIAQSVWRPW
Download sequence
Identical sequences H2P932
9600.ENSPPYP00000014900 ENSPPYP00000014900 ENSPPYP00000014900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]