SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015001 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015001
Domain Number 1 Region: 3-439
Classification Level Classification E-value
Superfamily Sema domain 1.44e-79
Family Sema domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1303-1428,1594-1750
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 780-872
Classification Level Classification E-value
Superfamily E set domains 0.000000000000002
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 871-961
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000759
Family E-set domains of sugar-utilizing enzymes 0.089
Further Details:      
 
Domain Number 5 Region: 958-1039
Classification Level Classification E-value
Superfamily E set domains 0.0000000000043
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 442-494
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000942
Family Plexin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015001
Domain Number - Region: 1100-1152
Classification Level Classification E-value
Superfamily E set domains 0.00266
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015001   Gene: ENSPPYG00000013413   Transcript: ENSPPYT00000015601
Sequence length 1818
Comment pep:known_by_projection chromosome:PPYG2:3:3043551:3095042:1 gene:ENSPPYG00000013413 transcript:ENSPPYT00000015601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQ
LPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAP
PAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLE
DHRFENTPEIAIRSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSD
PPPGAQSYAYLALNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGG
AGRGDLYSRLVSVFPARERLFAVFERPQGSPATRAAPAALCAFRFADVRAAIRAARTACF
VEPAPDVVAVLDSVVQGTGPACERKLNIQINLNESMQVVSRRVVTVAYGEPVHHVMQFDP
ADSGYLYLMTSHQIARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCANSSQQ
HFWTSASEGPSRCPAMTVLPAEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVA
RVPGPAFGHQIAYCNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQ
VYPHTACTSCLSAQWPCFWCSQQHSCVSNQSQCEASPNPTSPQDCPRTLLSPLAPVPTGG
SQNILVPLANTAFFQGAALECSFGLEEIFEAVWVNETVVRCDQVVLHTTQKSQVFPLSLQ
LKGRPARFLDSPEPMTVVVYNCAMGSPDCSQCLGREDLGHMCVWSDGCRLRGPLQPMAGT
CPAPEIRAIEPLSGPLDGGTLLTIRGRNLGQRLSDVAHGVWIGGVACELLPDRYTVSEEI
VCVTGPAPGPLSDVVTVNASKEGKSRDRFSYVLPLVHSLEPTMGPKAGGTRITIHGNDLH
VGSELQVLVNDTDPCTELMRTDTSIACTMPEGSLPAPVPVCVRFERQGCVHGNLTFWYMQ
NPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSP
GALSNASAPVDFFINGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWI
KHHPGEPLTLVIHKEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAEGQL
PITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKT
LLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLY
EERYVLPSQTLNSQGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFV
HALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTE
SVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLL
RENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVD
LEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKD
LDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILS
IREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDK
TDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTP
LSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKF
EQVVALMEDNIYECYSEA
Download sequence
Identical sequences H2P9C8
ENSPPYP00000015001 9600.ENSPPYP00000015001 ENSPPYP00000015001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]