SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015040 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015040
Domain Number 1 Region: 90-559
Classification Level Classification E-value
Superfamily Sema domain 1.14e-131
Family Sema domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 1404-1530,1725-1914
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-53
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 1093-1197
Classification Level Classification E-value
Superfamily E set domains 4.7e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.075
Further Details:      
 
Domain Number 4 Region: 1006-1094
Classification Level Classification E-value
Superfamily E set domains 9.67e-16
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 909-1008
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000291
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 562-614
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000366
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1194-1284
Classification Level Classification E-value
Superfamily E set domains 0.000000406
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 862-895
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000288
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015040   Gene: ENSPPYG00000013446   Transcript: ENSPPYT00000015641
Sequence length 1944
Comment pep:known_by_projection chromosome:PPYG2:3:5728399:5776599:-1 gene:ENSPPYG00000013446 transcript:ENSPPYT00000015641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWDGTCLHSHALFCPFPRAEAPGTVMLAPAGPERRGPRPQPAMPLPPRSLQVLLLLLL
LLLLLLPLPGMWAEAGLPGAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVYVGAVNRIYK
LSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSA
SQGICQFLRLDDLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQAKLFVGTPIDG
KSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSE
QFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQ
DAYLSRPGRALARQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLFTLRAIKEKIKERI
QSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKDDG
LTAVAAYDYRGRTVVFAGTRSGHIRKILVDLSNPGGRPALAYESVVAQEGSPILRDLVLS
PNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRGDACERADEP
QRFAADLLQCVQLTVQPRKCVCHHVPGSPLVLQAWNVPDLSAGVNCSFEDFTESESVLED
GRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVN
GSFPCHWCKYRHVCTHNAADCAFLEGRVNVSEDCPQILPSTQIYVPVGVVKPITLAARNL
PQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVSDLPVNLSVVWNG
NFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLRHHCAADTPASWM
HARHGSSRCADPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVRVGKVLCSPVES
EYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVTPTFYRVSPSRGP
LSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININR
AQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIEREN
GCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFVYYPDPVL
EPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTLTVSETQLLCEAPN
LTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSR
DADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVL
FPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASL
IMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKF
LKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPEN
ENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRPKASDMDLEWRQGRMARIILQDED
VTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYESMLRTASS
PDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGTLQK
FVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTWKSNCLPLRFWVN
VIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSW
VERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILAALEK
DEQARRQRLRSKLEQVVDTMALSS
Download sequence
Identical sequences H2P9G3
ENSPPYP00000015040 ENSPPYP00000015040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]