SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015061 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015061
Domain Number 1 Region: 25-273
Classification Level Classification E-value
Superfamily vWA-like 2.19e-82
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 269-358
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 525-607
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.11e-19
Family Integrin beta tail domain 0.00033
Further Details:      
 
Domain Number 4 Region: 484-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 5 Region: 441-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015061
Domain Number - Region: 410-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 366-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015061   Gene: ENSPPYG00000013466   Transcript: ENSPPYT00000015663
Sequence length 732
Comment pep:known_by_projection chromosome:PPYG2:3:7741171:7855844:1 gene:ENSPPYG00000013466 transcript:ENSPPYT00000015663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEM
RKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVD
SFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGK
LGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNF
TALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYP
GQRKCEGLKIGDTASFEVSVEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVG
LEPNSARCSGSGTYVCGLCECNPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDC
SCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCS
TDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLH
SGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTV
LREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEM
ASNPLYRKXXXXLPPPIFCQAFKPIVQKAYLPTHHCGTSPFNKFQTNSTNGHCGLMFPSP
RGWRGDLMKRSD
Download sequence
Identical sequences H2P9I3
ENSPPYP00000015061 ENSPPYP00000015061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]