SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015073 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015073
Domain Number 1 Region: 111-559
Classification Level Classification E-value
Superfamily Sema domain 3.14e-144
Family Sema domain 0.0000000713
Further Details:      
 
Domain Number 2 Region: 849-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000314
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 664-714
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000916
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 906-963
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000183
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 555-604
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 718-769
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 7 Region: 963-1007
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015073
Domain Number - Region: 609-661
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000131
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015073   Gene: ENSPPYG00000013476   Transcript: ENSPPYT00000015675
Sequence length 1091
Comment pep:known_by_projection chromosome:PPYG2:3:9651492:9780856:1 gene:ENSPPYG00000013476 transcript:ENSPPYT00000015675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCGFTPSPVAHHLVPGPPDTPAQQLRCGWTVGGWLLSLVGGLLPCLPPGARTAEGPTMV
LAGPLAVSLLLPSLTLLVSHLSSSQDVSSEHSSEQQLCALSEHPTVAFEDLQSWVSNFTY
PGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEE
ECQNYVRVLIVAGRKVFMCGTNAFSPVCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAV
ISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFF
LRENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQ
SAFHLPEQDLIYGVFTTNVNSIPASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPI
PNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQ
AKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARAL
FVGLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITA
CPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIAN
CSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCP
VPIFWASWGSWSKCSSNCGGGVQSRRRACENGNSCLGCGEFKTCNPEGCPEVRRNTPWTP
WLPVNVTQGGARQEQRFRFTCRAPLADPHGLQFGRRRTETRTCPADGSGACDTDALVEDL
LRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQD
CNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCAT
QACPGWSPWSEWSTCTEDGAQSRSRHCEELLPGPSACAGNSSQSRPCPYSEIPVILPASS
MEEAISCAGKRNRPLMLRSSQPSGTPLQSLDSFHILLQTAKLCWGPHCFEMGSISSTWWP
RASPASWALGS
Download sequence
Identical sequences H2P9J4
ENSPPYP00000015073 ENSPPYP00000015073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]