SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015181 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015181
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily HMG-box 1.14e-21
Family HMG-box 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015181   Gene: ENSPPYG00000013578   Transcript: ENSPPYT00000015786
Sequence length 941
Comment pep:known_by_projection chromosome:PPYG2:3:25087147:25368351:-1 gene:ENSPPYG00000013578 transcript:ENSPPYT00000015786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSNRNKDHSAEGEGVGKRPKRKCLQWHPLLAKKLLDFSEEEEEEDEEEDIDKVQLLGA
DGLEQDVGETEDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAV
LDPKEKQKYTDMAKEYKDAFMKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRD
LPSPKKAKTEEMPQLNFGMADPTQMGGLSMLLLAGEHALGTPEVSSGTCRPDVSESPELR
QKSPLFQFAEISSSTSHPDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKSALFQL
AEMCLASEGMKMEESKLIKAKESDGGRIKESEKGKEEKEIKMEKTDETRLQKETEFEKSA
KENVRDSKELRNFEALQIDDIMAIKMENPKEIRKEELEEDQKCRHFPDFSYSASSKIIIS
DVPSRKDHMCHPHGIMIIEDPAALNKPEKLKKKKKKSKMDRHGNDKSTPKKTCKKRQSSE
SDIESVIYTIEAVAKGDWGIEKLGDTPRKKVRTSSSGKGSILDAKPPKKKVKSREKKMSK
EKSSDTTKESRPPDFISISASKNISGEAPEGIKAEPLTPMEDALPPSLSGQAKPEDSDCH
RKIETCGSRKSERSCKGALYKTLVSEGMLTSLRANVDRGKRSSGKGNSSDHEGCWNEESW
TFSQSGTSGSKKFKKTKPKEDCLLGSAKLDEEFEKKFNSLPQYSPVTFDRKCVPVPRKKK
KTGNVSSEPTKTSKGPFQSQKKNLFHKIVSKYKHKKEKPNVPEKGSGDKWSNKQLFLDAI
HPTEAIFSEDRNTTEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKITHLVRTAD
GRVSPAGGTLDDKPKEQLQRSLPKATETDCNDECAHNTEVGETRSSTPEMPAVSAFFSLA
ALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAPVLISCADQ
Download sequence
Identical sequences H2P9U2
ENSPPYP00000015181 ENSPPYP00000024711 ENSPPYP00000015181 9600.ENSPPYP00000015181 XP_003776222.1.23681 XP_009236834.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]