SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015212 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000015212
Domain Number - Region: 531-596
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015212   Gene: ENSPPYG00000013607   Transcript: ENSPPYT00000015819
Sequence length 1135
Comment pep:known_by_projection chromosome:PPYG2:3:33302945:33402109:1 gene:ENSPPYG00000013607 transcript:ENSPPYT00000015819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRGSDTEGSAQKKFPRHTKGHSFQGPKNMKHRQQDKDSPSESDVILPCPKAEKPHSGS
GHQEEDLSRDDLLFLLSILEGELQARDEVIGILKSEKMDLALLEAQYGFVTPKKVLEALQ
RDAFQAKSAPWQEDIYEKPMNELDKVVEKHKESHRRILGQLLVAEKFHRQTILELEEEKR
KHKEYMEKSDEFICLLEQECERLKKLIDQEIKSQEEKEQEKEKRVTTLKEELTKLKSFAL
MVVDEQQRLTAQLTLQRQKIQELTTNAKETHTKLALAEARVQEEEQKATRLEKELQTQTT
KFHQDQDTIMAKLTNEDSQNRQLQQKLAALSRQIDELEETNRSLRKAEEELQDIKEKISK
GEYGNAGIMAEVEELRKRVLDMEGKDEELIKMEEQCRDLNKRLERETLQSKDFKLEVEKL
SKRIMALEKLEDAFNKSKQECYSLKCNLEKERMTTKQLSQELESLKVRIKELEAIESRLE
KTEFTLKEDLTKLKTLTVMFVDERKTMSEKLKKTEDKLQAAASQLQVEQNKVTTVTEKLI
EETKRALKSKTDVEEKMYSVTKERDDLKNKLKAEEEKGNDLLSRVNMLKNRLQSLEAIEK
DFLKNKLNQDSGKSTTALHQENNKIKELSQEVERLKLKLKDMKAIEDDLMKTEDEYETLE
RRYANERDKAQFLSKELEHVKMELAKYKLAEKTETSHEQSLFKRLQEEEAKSGHLSREVD
ALKEKIHEYMATEDLICHLQGDHSVLQKKLNQQENRNRDLGREIENLTKELERYRHFSKS
LRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLYEESEDQDEDPND
EGSVLSFKCSQSTPRPVNRKLWIPWMKSKEGHPQNGKIQTKPNASFVQPGDLVLSHTPGQ
PLHIKVTPDHVQNTATLEITSPTTENPHSYTSTAVIPNCGTPKQRITILQNASITPVKSK
TSTEDLMNLEQGMSPITMATFARAQTPESCGSLTPERTMSPIQVLAVTGSASSPEQGRSP
EPIEISAKHAIFRVSPDRQSSWQFQRSNSNSSSVITTEDNKIHIHLGSPYMQAVASPVRP
ASPSAPLQDNRTQGLINGALNKTTNKVTSSITITPTATPLPRQSQITVEPLLLPH
Download sequence
Identical sequences H2P9X2
ENSPPYP00000015212 XP_003776228.1.23681 ENSPPYP00000015212 9600.ENSPPYP00000015212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]