SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015215 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015215
Domain Number 1 Region: 291-450
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.35e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000279
Further Details:      
 
Domain Number 2 Region: 78-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 191-288
Classification Level Classification E-value
Superfamily LCCL domain 4.32e-24
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015215   Gene: ENSPPYG00000013610   Transcript: ENSPPYT00000015822
Sequence length 789
Comment pep:known_by_projection chromosome:PPYG2:3:34380508:34485361:1 gene:ENSPPYG00000013610 transcript:ENSPPYT00000015822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAVVRARRCLQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLL
LEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDI
EDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGF
LASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAG
VHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMES
GVIADPQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQIDLNKEKK
ITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNF
LPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRSPKLTQPPPPRNSNDLKNTTAPPK
IAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIKNTTVTPNVTKDVALAAVLVPVLVMV
LTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGFYLMVSLAYRHNEGWWKGMKQFFPAK
AVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKE
AGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTASVGLPSTSTFKAMGN
QPPPLVGTYNTLLSRTDSCSSAQAQYDTPKGGKPGPPAPDELVYQVPQSTQEVSGAGRDG
ECDVFKEIL
Download sequence
Identical sequences H2P9X5
9600.ENSPPYP00000015215 ENSPPYP00000015215 ENSPPYP00000015215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]