SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015350 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000015350
Domain Number - Region: 48-140
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00275
Family LacY-like proton/sugar symporter 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015350   Gene: ENSPPYG00000013728   Transcript: ENSPPYT00000015963
Sequence length 188
Comment pep:known chromosome:PPYG2:3:76645111:76666782:-1 gene:ENSPPYG00000013728 transcript:ENSPPYT00000015963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF
LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM
VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT
DYISKVKE
Download sequence
Identical sequences A0A024R371 A0A2I3GLS5 A0A2J8SWB6 G3QFA1 H2QMX1 O75915 Q5R4X8
ENSPTRP00000026062 ENSPPYP00000015350 ENSP00000273258 ENSNLEP00000002672 9598.ENSPTRP00000026062 9600.ENSPPYP00000015350 9606.ENSP00000273258 ENSP00000273258 ENSPTRP00000026062 ENSPPYP00000015350 ENSGGOP00000000968 gi|5453704|ref|NP_006398.1| ENSP00000273258 ENSNLEP00000002672 ENSGGOP00000000968 NP_001127640.1.23681 NP_006398.1.87134 NP_006398.1.92137 XP_003264921.1.23891 XP_003811630.1.60992 XP_004035919.1.27298 XP_012357633.1.23891 XP_516574.2.37143 1917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]