SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015367 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015367
Domain Number 1 Region: 290-498
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.54e-58
Family Reprolysin-like 0.00069
Further Details:      
 
Domain Number 2 Region: 586-642
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000706
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 1181-1237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000719
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 4 Region: 1378-1437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000127
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 1102-1163
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 6 Region: 993-1051
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000122
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 1046-1106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 8 Region: 1551-1610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 9 Region: 1232-1293
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000562
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 10 Region: 1442-1496
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 1325-1381
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 1613-1673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 13 Region: 1678-1726
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 14 Region: 1494-1552
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015367
Domain Number - Region: 877-930
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000719
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number - Region: 936-991
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00902
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015367   Gene: ENSPPYG00000013740   Transcript: ENSPPYT00000015980
Sequence length 1933
Comment pep:known_by_projection chromosome:PPYG2:3:81305805:81481640:1 gene:ENSPPYG00000013740 transcript:ENSPPYT00000015980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALG
EPFPTNAHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFI
APLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHD
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHRKDKKKTR
ARKWGERINLADDMAALNSGLATEAFSAYGNKTDNTREKRTHRRTKRFLSYPRFVEVLVV
ADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNEQDGPSISFNA
QTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSR
KYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRR
LWCNNVNGVHKGCRTQHTPWADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTC
SRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFRDEQCAHFDGK
HFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGQDTNDICV
QGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATNID
VRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKR
KLVRESDQLTVSDQRCDRLPQPGPVTEPCGTDCDLRWHVASRSECSAQCGLGYRTLDIYC
AKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRRRA
ICVNNRNDVLDDSKCTHQEKVTIQRCNEFPCPRWKSGDWSECLVTCGKGHKHRQVWCQFG
EDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYMSV
VDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGKGT
RMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRATRQ
VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPS
RTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGP
CPQWAYGSWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTNACPHD
AAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPKWK
AGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPVYTWRAE
EWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPSDRESCSLQPCEYVWITGEWS
ECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRECPVSATWR
VGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNIYNCELPQNCKEV
KRLKGASEDGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNPTE
CPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATAGD
CYSAAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDSTRVIGKCGGYCGKC
TPSSGTGLEVRVL
Download sequence
Identical sequences H2PAB9
ENSPPYP00000015367 ENSPPYP00000015367 9600.ENSPPYP00000015367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]