SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015421 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015421
Domain Number 1 Region: 254-432
Classification Level Classification E-value
Superfamily vWA-like 6.54e-26
Family Integrin A (or I) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015421   Gene: ENSPPYG00000013782   Transcript: ENSPPYT00000016034
Sequence length 972
Comment pep:known_by_projection chromosome:PPYG2:3:91269556:92168936:-1 gene:ENSPPYG00000013782 transcript:ENSPPYT00000016034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTVNQAEQLTDDQGPVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
LLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLL
QCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAE
QLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGPVNKSNVVTASTSI
QLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASVDGKCSISCDDETVNCYLIDNNGF
ILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPY
NAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTTKAQKLKQTLEPCDTEYPAFVSERTIKE
TTGNIACEDCSK
Download sequence
Identical sequences H2PAG9
ENSPPYP00000015421 ENSPPYP00000015421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]