SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015450 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015450
Domain Number 1 Region: 126-621
Classification Level Classification E-value
Superfamily Sema domain 8.5e-160
Family Sema domain 0.000000000181
Further Details:      
 
Domain Number 2 Region: 617-669
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000366
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 684-769
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000808
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015450   Gene: ENSPPYG00000013807   Transcript: ENSPPYT00000016063
Sequence length 878
Comment pep:known_by_projection chromosome:PPYG2:3:93895239:93908339:1 gene:ENSPPYG00000013807 transcript:ENSPPYT00000016063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALAGKIFPMGSWPVGHKSLHWANKVKGEAAGGRQGPGLLVSSAPLSAQDWVEPLPYK
WWPGGSRANYNRRPAGPEGPEGGSAGRRQRCPQFPSMGLLAWAICWLLGGLPLHGGSSGP
SPGPSVPRLRLSYQDLLSANRSAIFLGPQGSLNLQAMYLDEYRDRLFLGGLDALYSLRLG
QAWPDPREVLWPPQLGQREECVRKGRDPLTECANFVRVLQPHNRTHLLACGTGAFQPTCA
LITVGHRGEHVLYLESGSVESGRGRCPHEPSRPFASTFVDGELYTGLTADFLGREAMIFR
SGGPRPALRSDSDQSLLHDPRFVMAARIPENSDQDNDKVYFFFSETAPSPDGDSNHVTVS
RVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPGGAETHFDQLEDVFLLWPKAGKSLE
VYALFSTVSAVFQGFAICVYHMADIWEVFNGPFAHRDGPQHQWGPYGGKVPFPRPGVCPS
KMTAQPGRPFGSTKDYPDEVLQFARAHPLMFWPVRPRHGRPVLVKTHLAQHLHQIVVDRV
EAEDGTYDVIFLGTDSGSVLKVIALQAGGSAEPEEVVLEELQVFKVPTPITEMEISVKRQ
MLYVGSRLGVAQLRLHQCETYGTACAECCLARDPYCAWDGASCTHYRPSLGKRRFRRQDI
RHGNPALQCLSQSQEEEAVGLVAATTVYGTEHNSTFLECLPKSPQAAVRWLLQRPGDEGP
DQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFP
PEPKPEEPPARGGLASTPPKAWYKDILQLIGFANLPRVDEYCERVWCRGTTECSGSFRSR
SRGKQAKGKSWAGLELGKKMKSRMHAEHNRTPREVEAK
Download sequence
Identical sequences H2PAJ7
ENSPPYP00000015450 ENSPPYP00000015450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]