SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015502 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015502
Domain Number 1 Region: 29-154,186-521
Classification Level Classification E-value
Superfamily Sema domain 2.85e-165
Family Sema domain 0.000000000129
Further Details:      
 
Domain Number 2 Region: 583-666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000236
Family I set domains 0.061
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000314
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015502   Gene: ENSPPYG00000013854   Transcript: ENSPPYT00000016117
Sequence length 755
Comment pep:known_by_projection chromosome:PPYG2:3:96304549:96335426:-1 gene:ENSPPYG00000013854 transcript:ENSPPYT00000016117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVAGLLLWASLLTGAWPAFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDGNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPTPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEV
LFLGTDPAPVKTMTISSKRQQLYVASAVGVTHLSLHRCQAYGAACADCCLARDPYCAWDG
QACSRYTASSKRRSRRQDVRHGNPIRQCRGFNSNANKNAVESVQYGVAGSAAFLECQPRS
PQAAVKWLFQRDPGDRRREIRAEDRFLRTEQGLLLRALQLSDRGVYSCTATENNFKHVVT
RVQLHVLGRDAVHAALFPPLSVSAQPPPGAGPSTPPYQELAQLLAQPEVGLIHQYCQGYW
RHVPPSPREAPGAPRSPEPQDQKKPRNRRHHPPDT
Download sequence
Identical sequences H2PAP9
9600.ENSPPYP00000015502 ENSPPYP00000015502 ENSPPYP00000015502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]