SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015543 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015543
Domain Number 1 Region: 514-543,641-720
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000589
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015543   Gene: ENSPPYG00000013896   Transcript: ENSPPYT00000016162
Sequence length 737
Comment pep:known chromosome:PPYG2:3:97910757:97919576:1 gene:ENSPPYG00000013896 transcript:ENSPPYT00000016162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRRRDYHMERPLLNQEHLEELGRWGSAPRTRQWQTWLQCSRARARALLLQHLPVLVWL
PRYPVRDWLVGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRH
ISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGLI
HFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIYTVLEVCRKLPQ
SKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPIPIPGELLTLIGATGISYGMGLKHRFEVD
VVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAISLGKIFALRHGYRVDSNQELV
ALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFHDLP
KAVLAAIIIVNLKGMLRQLSDVRSLWKANRADLLIWLVTFTATILLNLDLGLVVAVIFSL
LLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVPGVKVFRSSATVYFANAEFYSDAL
KQRCGVDVDFLISQKKKLLKKREQLKLKQLQKEEKLQKQAASSKGASVSINVNTSLEDMR
SNNVEDCKTMVSPGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGALSFVD
TVCLKSLKNIFHDFREIEVEVYMAACQSPVVSQLEAGHFFDASITKKHLFASVHDAVTFA
LQHPRPVPDSPVSVTRL
Download sequence
Identical sequences H2PAT8
ENSPPYP00000015543 ENSPPYP00000015543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]