SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015552 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015552
Domain Number 1 Region: 65-288
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.48e-53
Family DnaQ-like 3'-5' exonuclease 0.0000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015552   Gene: ENSPPYG00000013903   Transcript: ENSPPYT00000016171
Sequence length 369
Comment pep:known_by_projection chromosome:PPYG2:3:98077558:98078667:-1 gene:ENSPPYG00000013903 transcript:ENSPPYT00000016171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQA
LPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPISQGPPPTVPPPPRVVD
KLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHN
GDRYDFPLLQAELALLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTR
LYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASARTKPRP
SAVTTTAHLATTRNTSPSLGESRRPKDLPPVKDLGALPREGLLAPLGLLAILTLAVATLY
GLSLATPGE
Download sequence
Identical sequences H2PAU7
ENSPPYP00000015552 ENSPPYP00000015552 9600.ENSPPYP00000015552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]