SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015603 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015603
Domain Number 1 Region: 146-457
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-115
Family Transglutaminase core 0.0000000573
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily E set domains 4.2e-40
Family Transglutaminase N-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 586-684
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.39e-23
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 
Domain Number 4 Region: 474-580
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000759
Family Transglutaminase, two C-terminal domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015603   Gene: ENSPPYG00000013951   Transcript: ENSPPYT00000016224
Sequence length 685
Comment pep:known chromosome:PPYG2:3:101685882:101728542:-1 gene:ENSPPYG00000013951 transcript:ENSPPYT00000016224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEAQRDLLQVLHVDFLKQENAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLK
LEFSTGPNPSLAKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSTPNAILGEYQLN
VKTGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKYKPW
NFGQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGVLIGNWTGDYEG
GTAPYKWTGSAPILQQYYNTKQAVRFGQCWVFAGILTTVLRALGIPARSVTAFDSAHDTE
RNLTVDTYVNENGEKITNMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQG
VFCCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHIISMETTSIGK
NISTKAVGQDRRRDITYEYKYSEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQS
DDVLLGNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEV
TLTLDSKTYINSLAILDDEPVIRGFIIAEIVESNEIMASEVFMSFQYPEFSIELPNTGRI
GQLLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQIKCTPIKTGP
KKFIVKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences H2PAZ5
9600.ENSPPYP00000015603 ENSPPYP00000015603 ENSPPYP00000015603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]