SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015628 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015628
Domain Number 1 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 341-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 201-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 303-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000124
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 387-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000128
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015628   Gene: ENSPPYG00000013971   Transcript: ENSPPYT00000016249
Sequence length 426
Comment pep:known_by_projection chromosome:PPYG2:3:103733983:103740663:-1 gene:ENSPPYG00000013971 transcript:ENSPPYT00000016249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYGAVASLAAFPFPKPALISQLERGETPWCSVPQGALDGEAPRGISSGYPSLKLAGI
SHPEQVEEPLNLKLQGEGPSLICPEGMLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCGS
QELWFGKTCEEKSRLGRWPGCLNGGSMESSTNDIIEVIVKDEMISVEESSETTDVNNLLG
IHHKILNEQIFYICEECGKCFDQNEDYDQHQKTHNGEKVYGCKECGKAFSFRSHCIAHQR
IHSGVKPYECQECAKAFVWKSNLIRHQRIHTGEKPFECKECGKGFSQNTSLTQHQRIHTG
EKPYTCKECGKSFTRNPALLRHQRMHTGEKPYECKDCGKGFMWNSDLSQHQRVHTGDKPH
ECTDCGKSFFCKAHLIRHQRIHTGERPYKCNDCGKAFSQNSVLIKHQRCHVRDKPYNCQI
SHLLEH
Download sequence
Identical sequences H2PB17
9600.ENSPPYP00000015628 ENSPPYP00000015628 ENSPPYP00000015628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]