SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015679 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015679
Domain Number 1 Region: 30-461
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-82
Family Integrin alpha N-terminal domain 0.00000115
Further Details:      
 
Domain Number 2 Region: 461-620
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-30
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 624-762
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-28
Family Integrin domains 0.004
Further Details:      
 
Domain Number 4 Region: 768-983
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000162
Family Integrin domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015679   Gene: ENSPPYG00000014017   Transcript: ENSPPYT00000016300
Sequence length 1035
Comment pep:known_by_projection chromosome:PPYG2:3:108888251:109295372:-1 gene:ENSPPYG00000014017 transcript:ENSPPYT00000016300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLSDEVIM
NRRYTYLGYAVTAGHFSHPSTTDVVGGAPQDKGIGKVYIFRADRRSGALIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGRKIN
PVLRMFGQSISGGIDMDGNGYPDVTMGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQLPRVYFVLLGETMG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLRGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDTANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
Download sequence
Identical sequences H2PB64
ENSPPYP00000015679 ENSPPYP00000015679 9600.ENSPPYP00000015679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]