SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015682 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000015682
Domain Number - Region: 658-733
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 387-498
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015682   Gene: ENSPPYG00000014020   Transcript: ENSPPYT00000016303
Sequence length 743
Comment pep:known_by_projection chromosome:PPYG2:3:109576576:109707238:1 gene:ENSPPYG00000014020 transcript:ENSPPYT00000016303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPGSGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKEY
SHHSFDRKWGQIQKWLEDSERARYSHRSSHHRPYLGVEDALSIRSLGSHRNPSKDITGTL
WSRASTPKRKDTMYDMFKDRSSRLSSLNHSYTHSHGMKKRSSGSHKDLLSGLYFDQRNYS
SLRHSKPTSAYYTRSSSLYSDPLATYKSDRASPTANSGLLRSASLASLYNGGLYNPYGSR
TPSECSYYSSRISSARSSPGFTNDDTASIVSSDRDSRGRRESVVSAADYFSRSNRRGSVV
SEVDDISIPDLSSLDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPD
TSLSELRDIYDLKDQIQDVEGRYMQGLKELKESLSEVEEKYKKAMVSNAQLDNEKNNLIY
QVDTLKDVIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEE
KQRMQQKIDTMTKEVFDLQETLLWKDKKIGALEKQKEYIACLRNERDMLREELADLQETV
KTGEKHGLVIIPDGTPNGDVSHEPLAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKE
ELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLS
KAEQDITTLEQSISRLEGQVLKYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEM
TNSHLAKRLEKMKANRTALLAQQ
Download sequence
Identical sequences H2PB67
ENSPPYP00000015682 ENSPPYP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]