SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015740 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015740
Domain Number 1 Region: 239-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000397
Family HkH motif-containing C2H2 finger 0.052
Further Details:      
 
Domain Number 2 Region: 37-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000794
Family HkH motif-containing C2H2 finger 0.047
Further Details:      
 
Domain Number 3 Region: 180-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000238
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015740   Gene: ENSPPYG00000014069   Transcript: ENSPPYT00000016361
Sequence length 395
Comment pep:known_by_projection chromosome:PPYG2:3:125681705:126018557:1 gene:ENSPPYG00000014069 transcript:ENSPPYT00000016361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQ
KAVINHTFGVPLPHRRKQIISCNICQLRFNSDSQAAAHYKGTKHAKKLKALEAMKNKQKS
VTAKDSAKTTFTSITTNTINTSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKS
PMTATGNSSCPSIETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGT
IKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPP
KPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVAVSSPFSLRTA
PAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY
Download sequence
Identical sequences H2PBC2
9600.ENSPPYP00000015740 XP_002814056.1.23681 ENSPPYP00000015740 ENSPPYP00000015740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]