SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015779 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015779
Domain Number 1 Region: 108-311
Classification Level Classification E-value
Superfamily vWA-like 1.13e-20
Family Integrin A (or I) domain 0.017
Further Details:      
 
Domain Number 2 Region: 1-68
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000426
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015779   Gene: ENSPPYG00000014103   Transcript: ENSPPYT00000016401
Sequence length 362
Comment pep:known_by_projection chromosome:PPYG2:3:133854391:134009516:-1 gene:ENSPPYG00000014103 transcript:ENSPPYT00000016401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQVVMNNLSPAWKSFKVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGA
MEGKQVQWECINPKYKAKKKNYKNSGIVILNLCKIHKMHSFLDYIMGGCQIQFTVAIDFT
ASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQDYDSDKMFPAFGFGARIPPEYTVSH
DFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQ
YFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGILRSPKG
EPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEMYESSRTL
AP
Download sequence
Identical sequences H2PBF7
ENSPPYP00000015779 9600.ENSPPYP00000015779 ENSPPYP00000015779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]