SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015960 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015960
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily POZ domain 7.85e-29
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 424-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 338-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 4 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-18
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 5 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000138
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015960   Gene: ENSPPYG00000014280   Transcript: ENSPPYT00000016599
Sequence length 610
Comment pep:known_by_projection chromosome:PPYG2:3:173333239:173349971:1 gene:ENSPPYG00000014280 transcript:ENSPPYT00000016599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENN
VFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAF
IANPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTK
KKKKAFNSPKTGQNKTVQYPSDILENASVDLFLDANKLPTPVVEQVAQINDNSELELTSV
VENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASIKSPYEAENSGEELDQRYSKA
KPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKC
ELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC
GQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSF
ISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTPDSSAEDHTLSE
QDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSE
PQLIFLQQLY
Download sequence
Identical sequences H2PBY2
ENSPPYP00000015960 9600.ENSPPYP00000015960 ENSPPYP00000015960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]