SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015979 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015979
Domain Number 1 Region: 14-52,97-254,282-496
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.92e-56
Family LacY-like proton/sugar symporter 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015979   Gene: ENSPPYG00000014295   Transcript: ENSPPYT00000016619
Sequence length 524
Comment pep:known_by_projection chromosome:PPYG2:3:174572930:174605424:-1 gene:ENSPPYG00000014295 transcript:ENSPPYT00000016619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEDKVTGTLVFTVITTVLGSFQFGYDIGVINAPQQVIMSHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEEAVAAAQLITMLWSLSVSSFAVGGMIASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRTEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLVAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
Download sequence
Identical sequences H2PBZ8
XP_002814322.1.23681 9600.ENSPPYP00000015979 ENSPPYP00000015979 ENSPPYP00000015979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]