SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016212 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016212
Domain Number 1 Region: 430-685
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.83e-77
Family PDEase 0.00000292
Further Details:      
 
Domain Number 2 Region: 52-249
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-38
Family GAF domain 0.00024
Further Details:      
 
Domain Number 3 Region: 235-407
Classification Level Classification E-value
Superfamily GAF domain-like 7.26e-25
Family GAF domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016212   Gene: ENSPPYG00000014504   Transcript: ENSPPYT00000016865
Sequence length 713
Comment pep:known_by_projection chromosome:PPYG2:4:605547:652186:1 gene:ENSPPYG00000014504 transcript:ENSPPYT00000016865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEGGCPPDCDSLRELCQVEESAALL
ELVQDAQESINMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDVGVVGHVAQTKKMVNVKDVAECPHFSSFADELTDYKTKNMLATPI
MNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLVYIGKEKEIVFYKVIDYILHGR
EEIKVIPTPPADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVL
SMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLSHFLGWSVMNPTRARLGKEPADC
DEDELGEILVLVRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLTTGKLSQNPLAKLHGS
SILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLMDIAIIATDLALYFKKRAMFQKI
VDESTIYKDKKSWVEYLSLETTRKEIVMAMMMTACDLSAITKPWEVQSKVALLVAAEFWE
QGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCTFVYKEFSRFHEEILPMFDRLQN
NRKEWKALADEYEAKVKALEEKKKEEERVAVKKVGTEICNGGPAPKSSTCCIL
Download sequence
Identical sequences H2PCL9
ENSPPYP00000016212 9600.ENSPPYP00000016212 ENSPPYP00000016212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]