SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016224 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016224
Domain Number 1 Region: 534-561,604-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.65e-16
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016224   Gene: ENSPPYG00000014515   Transcript: ENSPPYT00000016877
Sequence length 701
Comment pep:known_by_projection chromosome:PPYG2:4:936005:939217:-1 gene:ENSPPYG00000014515 transcript:ENSPPYT00000016877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESPEPLQQGRGLVLVRRQRPAPQGLLEMLKARLWQSCSCSVLCAQALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSILNSSAAMLDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIM
VATLVSHFGQLHKRFGSSVAGDIPTGFMPPRVPEPRLMQRVALDAVALALVGAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDSAFYEDTTEFEGLVPEPGVRVF
RFGGPLYYANKDFFLRSLYSLTGLDAGCVAARRKERGSERGVGEGGPAQGEDLGPVSSGA
ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYRALGISLLLACCSPPVRDVLSRG
GFLGEGPGDTAEEEQLFLSVHDAVQTARAGHRELEATDAHL
Download sequence
Identical sequences H2PCN0
XP_002814540.1.23681 XP_002814541.1.23681 9600.ENSPPYP00000016224 ENSPPYP00000016224 ENSPPYP00000016224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]