SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016247 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016247
Domain Number 1 Region: 402-838
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.45e-116
Family DNA polymerase I 0.000000229
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016247
Domain Number - Region: 271-378
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000354
Family DnaQ-like 3'-5' exonuclease 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016247   Gene: ENSPPYG00000014538   Transcript: ENSPPYT00000016903
Sequence length 883
Comment pep:known_by_projection chromosome:PPYG2:4:2081003:2236324:-1 gene:ENSPPYG00000014538 transcript:ENSPPYT00000016903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQL
EDGKNQSPEKKDLKSLRSQTSRGSAKLSLQSCSVRLTDQLSTDQKQKSISSLTLSSCLIP
QYNQEASVLQKKGHKRKHFLTENINNENKGSINLKREHVTYNNSSEKTSKQMALEEDTDE
AEAYLNSGNSGALKKHFCDIRHLDDWAKSQLIEMLKQAAALVVTVMYSDGSTQLGVDQTP
ISSVKGIVVLLKRQAEGGHGCPDAPACGPVLEGFVSDDPCIYIQIEHSAIWDQEQEAHQQ
FARNVLFQTLKCKCPVICFNAKDFVRIVLQFFGNDGSWKHVADFVGLDPRIAAWLIDPSD
ATPSFEDLVEKYCEKSITFKVNNTYGNSSRNIVIQNVREGYGLWQLFCTLELPLIPILAV
MESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGEPFLITSNNQLREILFGKLKLHLL
SQRNSLPRTGLQKYPSTSEAVLNALRDFHPLPKIILEYRQVHKIKSTFVDGLLACTKKGS
ISSTWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKEDKTLTISPRAMFVSSKGH
TFLAADFSQIELRILAHLSGDPELLKLFQEAERDDVFSTLTSQWKDVPMEQVTHADREQT
KKVVYAVVYGAGKERLAACLGVPVQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGYVVS
IMGRRRPLPRIHAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASRTLTARL
VAQIHDELLFEVEDPQIPECAALVRRTMESLEQVQALELQLQVPLKVSLSAGRSWGHLVP
LQEVWGPPPGPCRTESPSNSLATPGSPVSTQPPPPHFSPSFCL
Download sequence
Identical sequences H2PCQ3
ENSPPYP00000016247 ENSPPYP00000016247 9600.ENSPPYP00000016247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]