SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016268 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016268
Domain Number 1 Region: 181-505
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.1e-77
Family Pancreatic carboxypeptidases 0.00000187
Further Details:      
 
Domain Number 2 Region: 42-163
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.49e-32
Family Frizzled cysteine-rich domain 0.00066
Further Details:      
 
Domain Number 3 Region: 505-584
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.87e-18
Family Carboxypeptidase regulatory domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016268   Gene: ENSPPYG00000014560   Transcript: ENSPPYT00000016927
Sequence length 652
Comment pep:known_by_projection chromosome:PPYG2:4:4439063:4480176:-1 gene:ENSPPYG00000014560 transcript:ENSPPYT00000016927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPPLLLLTVLVVAAARPGCEFERNPAGECHRPPAADSATCVDLQLRTCSDAAYNHTT
FPNLLQHRSREVVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGWVRRPCRH
ICEGLREACQPAFDAIDMAWPYFLNCHRYFTREDEGCYDPLEKLRGGLEADEALPSGLPP
TFIRFSHHSYAQMVRVLRRTASRCAHVARTYSIGRSFDGRELLVIEFSSRPGQHELMEPE
VKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAA
AEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPE
TKAIMKWMQTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYAD
VHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPP
EEALYTLWQHNKESLLNFVEMVHRGIKGVVTDKFGKPVKNARILVKGIRHDITTAPDGDY
WRLLPPGVHIVIAQAPGYAKVIKKVIIPTRMKRAGRVDFILQPLGMGPKNFLHGLQRTGP
HDPLGGASSLGEATEPDPLRARRQPSADGSKPWWWSYFTSLSTHRPRWLLKY
Download sequence
Identical sequences H2PCS4
ENSPPYP00000016268 ENSPPYP00000016268 9600.ENSPPYP00000016268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]