SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016312 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000016312
Domain Number - Region: 54-159
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0327
Family LacY-like proton/sugar symporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016312   Gene: ENSPPYG00000014602   Transcript: ENSPPYT00000016975
Sequence length 165
Comment pep:known_by_projection chromosome:PPYG2:4:9141124:9152084:1 gene:ENSPPYG00000014602 transcript:ENSPPYT00000016975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSRARQQLRRRFLLLPDTEAQLDREGDAGPETSTAVEKKEKPLPRLNIHSGFWILASI
VVTYYVDFFKTLKENFHTSSWFLCGSALLLVSLSIAFYCIVYLEWYCGIGEYDVKYPALI
PITTASFIAAGICFNIALWHVWSFFTPLLLFTQFMGVVMFITLLG
Download sequence
Identical sequences H2PCW6
ENSPPYP00000016312 ENSPPYP00000016312 9600.ENSPPYP00000016312 XP_002814629.1.23681 XP_009238062.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]