SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016470 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016470
Domain Number 1 Region: 441-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-18
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 481-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000016
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000633
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016470
Domain Number - Region: 310-334,364-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000978
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 541-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00933
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 1211-1235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0167
Family Classic zinc finger, C2H2 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016470   Gene: ENSPPYG00000014745   Transcript: ENSPPYT00000017141
Sequence length 1250
Comment pep:known_by_projection chromosome:PPYG2:4:63054545:63082797:-1 gene:ENSPPYG00000014745 transcript:ENSPPYT00000017141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGRGAPSGHARRRRWGRVSRARAGVGGGVSRGRRRRRRRRRRGLGARRSVLCWNVRLPR
ARGAAAERAPPRPGAPDPGGGCGSRQGRARPGGLSTLCSPTPGPSWSTTAPAPNFSALPH
LSPETPATKKSSRRRSGDSGSPAPPHRGRPNTVMATQVMGQSSGGGGLFTSSGNIGMALP
NDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEERQMAELMPVGDNNFSDS
EEGEGLEESAEIKGEPHGLENMELRSLELSVVEPQPVFEASGAPEIYTSNKDLPPETPGA
EDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARESGSATAE
EGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTVSEYHWRKHL
RNHFPRKVYTCGKCNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTHLTRHMRTHS
GEKPFKCDQCSYVASNQHEVTRHARQVHNGPKPLNCPHCDYKTADRSNFKKHVELHVNPR
QFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTMDVSKVKLKKTKKREADLPDNITNEKTE
IEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPSNNVSMIQVTTRTRKSVTEMKEMDVHTG
SNSEKFSKTKKSKRKLEVDTHSLHGPVNDEESSTKKKKKVESKSKNNSQEVPKGDSKVEE
NKKQNTYMKKSTKKKTMKNKSSKKSSKPPQKEPVEKGSVQMDPPQMVPAPTEAVQKGPVQ
VEPPPPVEPAQMEGAQIWPAQDEPVQMEVVQEGPAQKELLPPVEPAQLVGAQMVPAHMEL
PPPMETAQTEVAQMGPAPMEPAQMEVVQVEPAPMQVVQKDPVQMELSPPMEVVQKEPVQI
ELPPPMEVVQKEPVQIELSPPIEVVQKEPVQMELSPPMGVVQREPAQREPPPPREPPLHM
EPISKKPPLRKDKKEKSNMQSERARKEQVLIEVGLVPVKDSWLLKESVSTEDLSPSSPPL
PKENLREEASGDQKLLNTDEGNKEAPLQKVGAEEADESLPGLAANINESTHVSSSGQNLN
TPEGETLNGKHQTDTIVCEMKMDTDQNARENLTGINSTVEEPVSPMLPPSAVEEHEAVSK
TALASPPATVAANESQEIDEDEGIHSHEGSDLSDNMSEGSDDSGLHGARPVPQESSRKNA
KEALAVKAAKGDFVCIFCDRSFRKGKDYSKHLNRHLVNVYYLEEAAQGQE
Download sequence
Identical sequences H2PDC1
ENSPPYP00000016470 ENSPPYP00000016470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]