SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016489 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000016489
Domain Number - Region: 121-318
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.023
Family Glycerol-3-phosphate transporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016489   Gene: ENSPPYG00000014763   Transcript: ENSPPYT00000017162
Sequence length 324
Comment pep:known_by_projection chromosome:PPYG2:4:64675586:64706270:-1 gene:ENSPPYG00000014763 transcript:ENSPPYT00000017162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPVPAQQLQPQPVAV
QGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM
AMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQA
LTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTV
TIIGGIVFLAFAFSALFISPDSGF
Download sequence
Identical sequences H2PDE0
ENSPPYP00000016489 9600.ENSPPYP00000016489 XP_002814829.1.23681 ENSPPYP00000016489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]