SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016761 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016761
Domain Number 1 Region: 110-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016761   Gene: ENSPPYG00000015008   Transcript: ENSPPYT00000017441
Sequence length 272
Comment pep:known_by_projection chromosome:PPYG2:4:117260911:117261729:-1 gene:ENSPPYG00000015008 transcript:ENSPPYT00000017441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSAEEEEEEEPGASGGARRQRGAEAG
QGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
LPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSASSNSTSPYSCTLSP
ASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Download sequence
Identical sequences H2PE52
XP_002815119.1.23681 ENSPPYP00000016761 ENSPPYP00000016761 9600.ENSPPYP00000016761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]