SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016779 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016779
Domain Number 1 Region: 437-682
Classification Level Classification E-value
Superfamily vWA-like 1.83e-69
Family Trunk domain of Sec23/24 0.00012
Further Details:      
 
Domain Number 2 Region: 199-454
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.62e-37
Family beta-sandwich domain of Sec23/24 0.0046
Further Details:      
 
Domain Number 3 Region: 685-780
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.19e-36
Family beta-sandwich domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 4 Region: 781-886
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.49e-29
Family Helical domain of Sec23/24 0.0043
Further Details:      
 
Domain Number 5 Region: 887-998
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.02e-25
Family C-terminal, gelsolin-like domain of Sec23/24 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016779   Gene: ENSPPYG00000015021   Transcript: ENSPPYT00000017459
Sequence length 1002
Comment pep:known_by_projection chromosome:PPYG2:4:123410809:123520779:-1 gene:ENSPPYG00000015021 transcript:ENSPPYT00000017459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATGGMLPPG
PPPPGPHQFGQNGAHATGHPPQRFTGPPPVNNVASSYAPYQPSAQSSYPGPISTSSVTQL
GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
PGASPLPLPMYRPDGLSGPPPPNAQYQTPPLPGQTLGAGYPPQQAANSGPQMASAQLSYP
GGFPGGPAQMAGPSQPQKKLDPDSIPSPIQVIENDRAFGGQVYATNTRGRFPPLVTTDCM
IQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAVVIKPFATIPSNESPLYLVNHGESGP
VRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG
SYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEET
SAIRVGFVTYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLL
DQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
LVNTDKEKILFQPQTNVYDALAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYK
YNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNTTTDVEMAA
IDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSC
ETDALINFFAKSAFKAVLQQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK
VLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKST
MLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNMPSFAHINTDMLTIV
KQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
Download sequence
Identical sequences H2PE70
ENSPPYP00000016779 ENSPPYP00000016779 9600.ENSPPYP00000016779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]