SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016859 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016859
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.79e-21
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016859   Gene: ENSPPYG00000015092   Transcript: ENSPPYT00000017540
Sequence length 141
Comment pep:novel chromosome:PPYG2:4:149145680:149146105:1 gene:ENSPPYG00000015092 transcript:ENSPPYT00000017540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDIPVPSSFNDVGQDWRLRRFVGQMWYEREVTLPEQWTQDLHTRVVLRTGSAHSCAIVWV
NGVDALEHEGSTSPLTPTSAACSRWGPCPPAPASLSPSTTCSSPPPCHQAPSSTWPTPPR
GYHPASTAYTHLPVPPRGALH
Download sequence
Identical sequences H2PEE3
9600.ENSPPYP00000016859 ENSPPYP00000016859 ENSPPYP00000016859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]