SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016872 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016872
Domain Number 1 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000887
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 582-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000544
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 781-831
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000102
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 98-106
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000102
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016872
Domain Number - Region: 198-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00496
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 696-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0685
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016872   Gene: ENSPPYG00000015104   Transcript: ENSPPYT00000017553
Sequence length 843
Comment pep:known_by_projection chromosome:PPYG2:4:151302725:151443943:-1 gene:ENSPPYG00000015104 transcript:ENSPPYT00000017553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFESFSSPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEV
AARAAGSLLAEKSSLLPEDPLPPPPSEKKPEKVTPPPPPPPPPPPPPPPQSLELLLLPVP
KGRVSKPSNSASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARK
DNLKSHMKVHQHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPDPDV
KGSPHLSDSACLGQQREGGGTELVGTMMTSNTPERTSQGGAGVSPLLVKEEPKEDNGLPT
SFTLNAADRPANHTKLKDPSEYVANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNF
KVKEEPKEGESLSTTLPRSSYVFSPESEASAPGVSEEALKPQEGKGSVLRRDVSVKAASE
LLMKLSAESYKETQMVKIKEEPMEVDIQDSHVSISPSRNVGYSTLIGREKTEPLQKMPEG
RVPPERNLFSQDISVKMASELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDTFRQSPFT
SNSKELLPSESVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSR
HLSLHTEERKYKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHP
YYYSCHVCGFETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTG
EDRKTPSESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMPGSQPSLNSEEK
PEKGFECVFCNFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTG
GLK
Download sequence
Identical sequences H2PEF6
ENSPPYP00000016872 ENSPPYP00000016872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]