SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017053 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017053
Domain Number 1 Region: 226-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-19
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 189-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000149
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 274-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000159
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017053   Gene: ENSPPYG00000015262   Transcript: ENSPPYT00000017745
Sequence length 311
Comment pep:known_by_projection chromosome:PPYG2:4:196299143:196300078:1 gene:ENSPPYG00000015262 transcript:ENSPPYT00000017745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQQLKKLAKTRRQKGLGGRAPSGAKPRHDKASQDLQAEIEPVSVVWALCDGYVCYEPGP
QALGEDDFSDCYIECIIRGEFSQPILEEDSRFESLEYLKKGSEQELSQKVLEASSLLECS
LEYMKKGAKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPIN
KEYDSLSAIACPQSGCTKKLRNRAALRKHLLIHGPRNHVCAECGKAFVESSKLKRHFLVH
TGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTH
ANTNENEQDGK
Download sequence
Identical sequences H2PEY2
9600.ENSPPYP00000017053 XP_002815405.1.23681 ENSPPYP00000017053 ENSPPYP00000017053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]