SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017073 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017073
Domain Number 1 Region: 157-219
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.23e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017073   Gene: ENSPPYG00000015283   Transcript: ENSPPYT00000017766
Sequence length 354
Comment pep:known_by_projection chromosome:PPYG2:4_random:15851918:15852982:1 gene:ENSPPYG00000015283 transcript:ENSPPYT00000017766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQARQHPVYPPELSLLDSTD
PRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEADGRGELVRRSSGGASSSKSPG
PVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFD
QLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRT
AASYEGGAGNATATGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDS
ALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Download sequence
Identical sequences H2PF02
ENSPPYP00000017073 XP_002832849.1.23681 ENSPPYP00000017073 9600.ENSPPYP00000017073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]