SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017134 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017134
Domain Number 1 Region: 41-460
Classification Level Classification E-value
Superfamily Sema domain 5.62e-126
Family Sema domain 0.000000262
Further Details:      
 
Domain Number 2 Region: 807-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 6.8e-17
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 753-804
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000222
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 565-615
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000458
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 456-508
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000143
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 620-671
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000746
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 7 Region: 866-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000837
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 509-562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017134   Gene: ENSPPYG00000015339   Transcript: ENSPPYT00000017829
Sequence length 1044
Comment pep:known_by_projection chromosome:PPYG2:5:9557147:9988212:-1 gene:ENSPPYG00000015339 transcript:ENSPPYT00000017829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGTCVIAWLFSSLGLWRLARPEAQGTTQCQRAEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSAGGELYAATAMDFKERDPAIYQSLGILPPLRTAQYN
SKWLNEPNFVSSYDIGNFTYFFFRENAVEHDCGKTVFSRAARVCKNDIGGRFLLEDTWTT
FMKARLNCSRPGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQA
FSGPFKYQENSRSAWLPYPNPNPHFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVT
TVPSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRAPLNQTSSSCLLEEIEL
FPDRRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVM
KKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGMWSPWTPCTHTDGSAVGSCLCRTRSC
DSPAPQCGGWQCEGPSMEIANCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHG
GRVCVGQNREERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRICENGPDCAGCN
VEYQSCNTNPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRI
EMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRV
CNNPEPKYGGMPCLGPSLEYQECNILPCPVDGVWSCWSPWTKCSATCGGGHYMRTRSCSN
PAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCILLFPMGSQC
SGNTTERRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMIAVGLSSSILGCLLTLLVY
TYCQRYQQQSHDATVIHPVSPAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKY
FNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences H2PF61
ENSPPYP00000017134 ENSPPYP00000017134 9600.ENSPPYP00000017134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]