SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017162 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017162
Domain Number 1 Region: 645-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 589-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 701-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 744-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 6 Region: 27-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000667
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 7 Region: 243-364
Classification Level Classification E-value
Superfamily SET domain 0.000000262
Family Viral histone H3 Lysine 27 Methyltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017162   Gene: ENSPPYG00000015366   Transcript: ENSPPYT00000017860
Sequence length 810
Comment pep:novel chromosome:PPYG2:5:24330828:24349749:1 gene:ENSPPYG00000015366 transcript:ENSPPYT00000017860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPERSQEESPEDDTERTERKPTVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMP
KASFNNESSLKELSETANLLNASGSEQAQKPVSPPGEASTSGQHSRLKLELRSKETEGNT
YSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
TLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITKDEEAANNGYSWLITKGRN
CYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDE
YGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS
ARKLLQPENPCPGDQNHEQQYSDPRSCNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
KGQMGSCRVGKRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVI
THQRTHTGEKPYVCRECGRGFSRQSVLLIHQRTHTGEKPYVCRECGRGFSRRSVLLIHQR
THTGEKPYVCRECGRGFSQQSVLLIHQRTHTGEKPYVCRECGRGFSRRSVLLIHQRTHTG
EKPYVCRECGRGFSWKSVLLRHQRTHTGEKPYVCRECGRGFSQQSVVFIHQRTHTGEKPY
VCRECGRGFSGKSVLFRHQRTHTGEKPYVCRECGRGFSDKSGVCYHQRTHTGEKPYVCRE
CGRGFSVKSNLLSHQRTHTEEKLYVCREDE
Download sequence
Identical sequences H2PF88
ENSPPYP00000017162 ENSPPYP00000017162 9600.ENSPPYP00000017162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]