SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017182 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017182
Domain Number 1 Region: 214-316
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.07e-23
Family Reprolysin-like 0.0034
Further Details:      
 
Domain Number 2 Region: 350-405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000222
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 3 Region: 1286-1345
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000122
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 753-805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 633-691
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000562
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 1233-1286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1174-1238
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0087
Further Details:      
 
Domain Number 8 Region: 1129-1179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 9 Region: 690-749
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000111
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017182   Gene: ENSPPYG00000015383   Transcript: ENSPPYT00000017881
Sequence length 1408
Comment pep:known_by_projection chromosome:PPYG2:5:34754717:35102562:-1 gene:ENSPPYG00000015383 transcript:ENSPPYT00000017881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRV
DASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIME
KRYGNLSRVKMMASSASLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVK
KHPLVEGGYHPHIVYRRQKVPETDEATCGLKQGLKIVHHAEKTLSSFCKWQKSINPKSDL
NPVHHDVAVLLTRKDICAGFNRPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHEL
GHNVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPESIPGGWGRWSPW
SHCSRTCGAGVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSEAPTFRQMQCSEF
DTVPYKNELYHWFPIFNPAHPCELYCRPIDGQFSEKMLDAVIDGTPCFEGGNSRNVCING
ICKMVGCDYEIDSNATEDRCGVCLGDGSSCQTVRKMFKQKEGSGYVDIGLIPKGARDIRV
MEIEGAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDRKGDLEKLMATGPTNE
SVWIQLLFQVTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGHWTECSVTCGTGIRRQTAHC
IKKGRGMVKATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGPHGEKKRTVLCI
QTMGSDEQALPPTDCQHLLKPKTLLSCNRDILCPSDWTVGNWSECSVSCGGGVRIRSVTC
AKNHDEPCDVTRKPNSRALCGLQQCPSSRRVLKPNKGTTSNGKNPPTPDQDPLKPVPLPT
SRPRMLTTPTGPESVSASTPAISSPSPTTASKEGDLGGKQWQDSSTQPELSSPYLISTGS
TSQPILTSQSLSIQPSEENVSSSDTGPTSEGGLVATTRSGSGLSSSRNPITWPVTPFYNT
LTKGPEVEIHSGSGEDREQPEDKDESNPVIWTKIRVPGNDAPVESTEMPLAPPLTPYLSR
ESPWPPFSTVMEGLLPSQRPSTPKTGTPRVEGMVTEKPANTLLPLGGDHQPEPSGKTANH
NHLKLPNSMNQTKSSEPVLTEEDATSLIAEGFLLNASNYKQLTNGHGSAHWIIGNWSECS
TTCGLGAYWRRVECSTQMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCSRNCSGGFKI
REIQCVDSRDHRNLRPFHCQFLAGIPPPLSMSCNPEPCEAWQVEPWSQCSRSCGGGVQER
GVFCPGGLCDWTKRPTSTMSCNEHLCCHWATGNWDLCSTSCGGGFQKRTVQCVPSEGNKT
EDQDQCLCDHKPRPPEFKKCNQQACKKSADLLCTKDKLSASFCQTLKAMKKCSVPTVRAE
CCFSCPQTHITHPQRQRRQRLLQKPKEL
Download sequence
Identical sequences H2PFA5
ENSPPYP00000017182 9600.ENSPPYP00000017182 ENSPPYP00000017182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]