SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017235 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017235
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000809
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 699-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000607
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 5 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000114
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017235   Gene: ENSPPYG00000015426   Transcript: ENSPPYT00000017935
Sequence length 934
Comment pep:known_by_projection chromosome:PPYG2:5:42172762:42256285:-1 gene:ENSPPYG00000015426 transcript:ENSPPYT00000017935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCSVLYFILLSALINKGQACFCDHYPWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETSECNWQRCPINCLLGDFGPWSDCDPCVEKQSKVRSVLRPSQFGGQPCTEP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYDPIPTVQLMGSGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDIFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIEGAEKSISLIRGGRSEYAAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKAFQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGHWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEIDLPEIEADSGCPQPIPPENGFIRNEKK
LYSVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLIKLKGHCQPGQKQS
GSECICMYPEEDCSHYSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERARLSSNSTKKESCGYDTCYDWEKCSASTSNVSAYCPHNASRVETNSTVAKW
DHQQGEKTLNICEVGAIRCANRKMEILHPGKCLA
Download sequence
Identical sequences H2PFF7
ENSPPYP00000017235 ENSPPYP00000017235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]