SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017264 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017264
Domain Number 1 Region: 29-148,339-664
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.66e-73
Family Integrin alpha N-terminal domain 0.0000638
Further Details:      
 
Domain Number 2 Region: 167-360
Classification Level Classification E-value
Superfamily vWA-like 4.9e-52
Family Integrin A (or I) domain 0.000000012
Further Details:      
 
Domain Number 3 Region: 667-810
Classification Level Classification E-value
Superfamily Integrin domains 2.09e-33
Family Integrin domains 0.00091
Further Details:      
 
Domain Number 4 Region: 813-939
Classification Level Classification E-value
Superfamily Integrin domains 4.34e-22
Family Integrin domains 0.011
Further Details:      
 
Domain Number 5 Region: 946-1145
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-19
Family Integrin domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017264   Gene: ENSPPYG00000015450   Transcript: ENSPPYT00000017965
Sequence length 1179
Comment pep:known_by_projection chromosome:PPYG2:5:54013022:54181421:1 gene:ENSPPYG00000015450 transcript:ENSPPYT00000017965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRLRARPGVAVACCWLLTVVLHSCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPSVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEEE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKAGQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLLENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
VSIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLHPT
GLSSSDNANCRPHIFEDPFSINSGKKMTTSTDQLKRGTILDCNTCKFATITCNLTPSDIS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences H2PFI5
ENSPPYP00000017264 XP_002815595.1.23681 9600.ENSPPYP00000017264 ENSPPYP00000017264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]