SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017266 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017266
Domain Number 1 Region: 17-125,317-625
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.2e-63
Family Integrin alpha N-terminal domain 0.0000503
Further Details:      
 
Domain Number 2 Region: 145-340
Classification Level Classification E-value
Superfamily vWA-like 3.53e-52
Family Integrin A (or I) domain 0.00000000672
Further Details:      
 
Domain Number 3 Region: 910-1111
Classification Level Classification E-value
Superfamily Integrin domains 4.87e-41
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 4 Region: 768-905
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-25
Family Integrin domains 0.0038
Further Details:      
 
Domain Number 5 Region: 629-767
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-17
Family Integrin domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017266   Gene: ENSPPYG00000015452   Transcript: ENSPPYT00000017967
Sequence length 1157
Comment pep:known_by_projection chromosome:PPYG2:5:54259652:54326700:1 gene:ENSPPYG00000015452 transcript:ENSPPYT00000017967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GILNCCLAYNVGLPEKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPERMGDVYKC
PVDSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTRNMGTGGFLTCGPLWAQQCGNQYY
TTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDI
GPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAY
SAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKN
LIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFS
ADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPKQAFDQILQDRNHSSYLGYSVAAI
STGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHQGDQIGSYFGSVLCSIDVDKDT
ITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAALSDI
NMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDG
YGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAK
FRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENNERCLQKNMVVNEAQSCPEHIIYI
QEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVR
QIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPVDGTEVT
CQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADN
LVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPV
SMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNTDINPLKIGQTSSSVSFKSENFRH
TKELNCRTASCSNVTCWLKDLHMKGEYFINVTTRIWNGTFASSTFQTVQLTTAAEINTYN
PEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYE
KMTKNPDEIDETTELSS
Download sequence
Identical sequences H2PFI7
ENSPPYP00000017266 ENSPPYP00000017266 9600.ENSPPYP00000017266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]