SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017356 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017356
Domain Number 1 Region: 416-520
Classification Level Classification E-value
Superfamily occludin/ELL-like 9.15e-33
Family Occludin/ELL domain 0.000000896
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017356
Domain Number - Region: 58-270
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000144
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017356   Gene: ENSPPYG00000015530   Transcript: ENSPPYT00000018061
Sequence length 522
Comment pep:known chromosome:PPYG2:5:71224842:71295522:1 gene:ENSPPYG00000015530 transcript:ENSPPYT00000018061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSIGYPYGGSGFGSYGSGYGY
SYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSSGNFETPSKRAPAKGRAAKSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Download sequence
Identical sequences H2PFS2
ENSPPYP00000017356 ENSPPYP00000017356 9600.ENSPPYP00000017356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]