SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017418 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000017418
Domain Number - Region: 159-279
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0327
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 
Domain Number - Region: 64-113
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0405
Family Sec2 N-terminal region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017418   Gene: ENSPPYG00000015581   Transcript: ENSPPYT00000018124
Sequence length 338
Comment pep:known chromosome:PPYG2:5:78483106:78594041:1 gene:ENSPPYG00000015581 transcript:ENSPPYT00000018124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGSVKMPNVPNTQ
PAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNW
PPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSAR
AVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFH
NWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQ
QEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI
Download sequence
Identical sequences A0A0D9RRX8 A0A2I3LWG6 A0A2K5WJX2 A0A2K6B7R1 A0A2K6N2L6 G3RGR7 G7MUU1 H2PFY2 K7CXN6
ENSPPYP00000017418 9600.ENSPPYP00000017418 ENSPPYP00000017418 XP_002804485.2.72884 XP_003805101.1.60992 XP_004058702.1.27298 XP_005557284.1.63531 XP_007974355.1.81039 XP_011728401.1.29376 XP_017751030.1.44346 ENSPANP00000000910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]