SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017421 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017421
Domain Number 1 Region: 475-767
Classification Level Classification E-value
Superfamily Folate-binding domain 3.3e-84
Family Aminomethyltransferase folate-binding domain 0.000028
Further Details:      
 
Domain Number 2 Region: 52-265,376-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-58
Family FAD-linked reductases, N-terminal domain 0.00041
Further Details:      
 
Domain Number 3 Region: 265-375
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.45e-29
Family L-aminoacid/polyamine oxidase 0.007
Further Details:      
 
Domain Number 4 Region: 769-855
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 7.19e-22
Family Aminomethyltransferase beta-barrel domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017421   Gene: ENSPPYG00000015584   Transcript: ENSPPYT00000018127
Sequence length 866
Comment pep:known_by_projection chromosome:PPYG2:5:79135565:79207791:-1 gene:ENSPPYG00000015584 transcript:ENSPPYT00000018127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPGAQLLRGLLLRSCPLQGSPGRPRSVCGREGEEKPPLSAETQWKDRAETVIIGGGCV
GVSLAYHLAKAGMKDVVLLEKSALTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYIIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKARSDGTWDVETPQGSMR
ANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYL
RQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDLDRIMEHIKAAMEMVPVLK
KADIINVVNGPITYSPDILPVVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEP
PFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYQRLES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVGVTDLSPFGKF
NIKGQDSIRLLDHLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSE
LHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTK
SLKVSNIPVTAIRISYTGELGWELYHRREDSVVLYDAIMNAGQEEGIDNFGTYAMNALRL
EKAFRAWGLEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATD
DVDPEGNESIWYNGKVVGNTTSGSYSYSIQRSLAFAYVPVELSEVGQQVEVELLGKNYPA
VIIQEPLVLTEPTRNRLQKKGGKDKT
Download sequence
Identical sequences H2PFY5
XP_002815732.1.23681 ENSPPYP00000017421 ENSPPYP00000017421 9600.ENSPPYP00000017421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]