SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017590 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017590
Domain Number 1 Region: 400-547
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 6.41e-46
Family Lamin A/C globular tail domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 320-387
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.14e-17
Family Intermediate filament protein, coiled coil region 0.0000724
Further Details:      
 
Domain Number 3 Region: 31-64
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000942
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017590
Domain Number - Region: 122-215
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00118
Family Myosin rod fragments 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017590   Gene: ENSPPYG00000015729   Transcript: ENSPPYT00000018300
Sequence length 586
Comment pep:known_by_projection chromosome:PPYG2:5:128138883:128202776:1 gene:ENSPPYG00000015729 transcript:ENSPPYT00000018300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSAL
QLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLN
YAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAA
KKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYEY
KLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI
ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDY
EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSV
SYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA
QRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRTSNRSCAIM
Download sequence
Identical sequences H2PGE3
9600.ENSPPYP00000017590 ENSPPYP00000017590 ENSPPYP00000017590 XP_002815878.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]