SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017604 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017604
Domain Number 1 Region: 322-542
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.2e-49
Family Reprolysin-like 0.0076
Further Details:      
 
Domain Number 2 Region: 1087-1143
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 915-976
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 980-1036
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 1038-1082
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 6 Region: 635-685
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000602
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017604
Domain Number - Region: 143-153
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017604   Gene: ENSPPYG00000015743   Transcript: ENSPPYT00000018314
Sequence length 1207
Comment pep:known_by_projection chromosome:PPYG2:5:130858417:131147456:1 gene:ENSPPYG00000015743 transcript:ENSPPYT00000018314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDTAGGSGGSADP
GWVRGVGGGGGARAQAAGSSREVRSVAPVPLEEPVEGRSESRLRPPPPSEGEEDEELESQ
ELPRGSSGAAALSPGAPASWQPPPPPQPPPSPPPAQHAEPDGDEVLLRIPAFSRDLYLLL
RRDGRFLAPRFAVEQRPNPGPGPTGAASAPQPPAPPDAGCFYTGAVLRHPGSLASFSTCG
GGLMGFIQLNEDFIFIEPLNDTMAITGHPHRVYRQKRSMEEKVTEKSALHSHYCGIISDK
GRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGADAARRFILTILNMVFNL
FQHKSLGVQVNLRVIKLILLHETPPELYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMST
SWGEDMTSVDAAILITRKDFCVHKDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTI
AHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKASNC
LLQTNPQSVSSVMVPSKLPGMTYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEGEKE
CRTKLDPPMDGTDCDPGKWCKAGECTSRTSAPEHLAGEWSLWSPRSRTCSAGISSRERKC
PGLGSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHVLQWQAVLDEE
KPCALFCSPVGKEQPILLSEKVMDGTSCGYQGLDICANGRCQKVGCDGLLGSLAREDHCG
VCNGNGKSCKIIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSYLALRDASKQSIN
SDWKIEHSGAFNLAGTTVHYVRRGLWEKISAKGPTTAPLHLLVLLFQDQNYGLHYEYTIP
SDPLPENQSSKAPEPLFMWTHTSWEDCDATCGGGERKTTVSCTKIMSKNISIVDNKKCKH
LTKPEPQIRKCNEQPCQTRWMMTEWTPCSRTCGKGMQSRQVACTQQLSNGTLIRARERDC
IGPKPASAQRCEGQDCMTVWEAGVWSECSVKCGKGVRHRTIRCTNPRKKCVLSTRPREAE
DCEDYSKCYVWRMGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHL
QPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYA
QKLQQKS
Download sequence
Identical sequences H2PGF7
ENSPPYP00000017604 XP_002815891.2.23681 9600.ENSPPYP00000017604 ENSPPYP00000017604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]