SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017669 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017669
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017669   Gene: ENSPPYG00000015801   Transcript: ENSPPYT00000018380
Sequence length 237
Comment pep:known_by_projection chromosome:PPYG2:5:137038712:137039425:-1 gene:ENSPPYG00000015801 transcript:ENSPPYT00000018380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASALGPPAPARRGAPNISRASE
VPGTQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYGPGDPVFSFPSLPKDLLHTTPCFIPYH
Download sequence
Identical sequences H2PGL6
XP_002815948.1.23681 ENSPPYP00000017669 9600.ENSPPYP00000017669 ENSPPYP00000017669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]