SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017834 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017834
Domain Number 1 Region: 494-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.45e-111
Family PDEase 0.000000311
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 1.08e-32
Family GAF domain 0.00042
Further Details:      
 
Domain Number 3 Region: 237-293,322-455
Classification Level Classification E-value
Superfamily GAF domain-like 9.25e-30
Family GAF domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017834   Gene: ENSPPYG00000015939   Transcript: ENSPPYT00000018549
Sequence length 857
Comment pep:known_by_projection chromosome:PPYG2:5:151782790:151888617:-1 gene:ENSPPYG00000015939 transcript:ENSPPYT00000018549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSVEESEI
IFDLLRDFQENLQTEKCIFNVMKKLCFLLQADRMSLFMYRTRNGIAELATRLFNVHKDAV
LEDCLVMPDQEIVFPLDMGIVGHVAHSKKITNVPNTEEDEHFCDFVDILTEYKTKNILAS
PIMNGKDVVAIIMAVNKVDGSHFTKRDEEILLKYLNFANLIMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKVRKLQQQTFPRKKK
YNFSLFCQEINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPAYVAQNGLICNIMNAP
TEDFFAFQKEPLDESGWMIKNVLAMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLMESL
TQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECE
EEELAEILQAELPDADKYEIHKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALV
RFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHDIDH
RGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIHMMD
IAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACDLSA
ITKPWEVQSQVALLVAAEFWEQGDLERMVLQQNPIPMMDRNKADELPKLQVGFIDFVCTF
VYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKMKVQEEKKQKQQSAKSAAAGNQLG
GNASPGGATTSKSCCIQ
Download sequence
Identical sequences H2PH20
9600.ENSPPYP00000017834 ENSPPYP00000017834 ENSPPYP00000017834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]